DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT1G06260

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_563764.1 Gene:AT1G06260 / 837137 AraportID:AT1G06260 Length:343 Species:Arabidopsis thaliana


Alignment Length:327 Identity:87/327 - (26%)
Similarity:135/327 - (41%) Gaps:82/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLSDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDEL 87
            |..:.|.::..|:.|...:|.|..:       .||       ||...|         ..:....:
plant    86 LTDNRFADMTNSEFKAHFLGLNTSS-------LRL-------HKKQRP---------VCDPAGNV 127

  Fly    88 PEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSC-CHT 151
            |:..|.|.|....|    ||:||.||.||||.||.|:.....|.:|..|:  .|...|:.| ..|
plant   128 PDAVDWRTQGAVTP----IRNQGKCGGCWAFSAVAAIEGINKIKTGNLVS--LSEQQLIDCDVGT 186

  Fly   152 CGFGCNGGFPGAAWSY-WTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSH 215
            ...||:||....|:.: .|..|:.:...|       ||.      .:.||               
plant   187 YNKGCSGGLMETAFEFIKTNGGLATETDY-------PYT------GIEGT--------------- 223

  Fly   216 VCQSGYTVDYAKDKHFGSKSY-SVRRNVREIQ----EEIMTNGPVEGAFTVYEDLILYKDGVYQH 275
             |..    :.:|:|....:.| .|.:|...:|    ::.::.|...|.| :::   ||..||:.:
plant   224 -CDQ----EKSKNKVVTIQGYQKVAQNEASLQIAAAQQPVSVGIDAGGF-IFQ---LYSSGVFTN 279

  Fly   276 EHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH----CGIESSISAG 336
            ..|..| .|.:.::|:||.|::|  ||::.|||.|.||:.|:.|:.||...    |||  ::.|.
plant   280 YCGTNL-NHGVTVVGYGVEGDQK--YWIVKNSWGTGWGEEGYIRMERGVSEDTGKCGI--AMMAS 339

  Fly   337 LP 338
            .|
plant   340 YP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/39 (18%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 74/258 (29%)
AT1G06260NP_563764.1 Inhibitor_I29 43..98 CDD:214853 2/11 (18%)
Peptidase_C1 127..341 CDD:365882 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.