DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CEP1

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_568722.1 Gene:CEP1 / 835091 AraportID:AT5G50260 Length:361 Species:Arabidopsis thaliana


Alignment Length:319 Identity:87/319 - (27%)
Similarity:130/319 - (40%) Gaps:54/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IEVVRSKAKTWTVGRNFDASVTEGHIRR-LMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFD 92
            |.....|.|::.:..|....:|....|| ..|.:...|:....:|:.....:|.| |:.||...|
plant    68 IHETNKKDKSYKLKLNKFGDMTSEE
FRRTYAGSNIKHHRMFQGEKKATKSFMYAN-VNTLPTSVD 131

  Fly    93 SRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCN 157
            .||.....|    :::||.|||||||..|.|:.....|.:  |.....|..:||.|......|||
plant   132 WRKNGAVTP----VKNQGQCGSCWAFSTVVAVEGINQIRT--KKLTSLSEQELVDCDTNQNQGCN 190

  Fly   158 GGFPGAAWSYWTRK-GIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGY 221
            ||....|:.:...| |:.|...|       ||:.|......|....|..                
plant   191 GGLMDLAFEFIKEKGGLTSELVY-------PYKASDETCDTNKENAPVV---------------- 232

  Fly   222 TVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVYQHEHGKELGGHA 285
            ::|..:|         |.:|..:...:.:.|.||..|... ..|...|.:||:....|.|| .|.
plant   233 SIDGHED---------VPKNSEDDLMKAVANQPVSVAIDAGGSDFQFYSEGVFTGRCGTEL-NHG 287

  Fly   286 IRILGWG--VWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH----CGIESSISAGLP 338
            :.::|:|  :.|.:   ||::.|||..:||:.|:.|:.||..|    |||  ::.|..|
plant   288 VAVVGYGTTIDGTK---YWIVKNSWGEEWGEKGYIRMQRGIRHKEGLCGI--AMEASYP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/35 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/255 (28%)
CEP1NP_568722.1 Inhibitor_I29 38..92 CDD:214853 5/23 (22%)
Peptidase_C1 126..342 CDD:278538 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.