DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and SAG12

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_568651.1 Gene:SAG12 / 834629 AraportID:AT5G45890 Length:346 Species:Arabidopsis thaliana


Alignment Length:321 Identity:87/321 - (27%)
Similarity:129/321 - (40%) Gaps:48/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRS--KAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVN-SVDELP 88
            |.||.:.|  ..:|:.:..|..|.:|....|.:..........:...:.::....|.| |...||
plant    67 ERIEHLNSIPAGRTFKLAVNQFADLTNDE
FRSMYTGFKGVSALSSQSQTKMSPFRYQNVSSGALP 131

  Fly    89 EEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG 153
            ...|.||:....|    |::|||||.||||.||.|:.....|..|..::  .|...||. |.|..
plant   132 VSVDWRKKGAVTP----IKNQGSCGCCWAFSAVAAIEGATQIKKGKLIS--LSEQQLVD-CDTND 189

  Fly   154 FGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQ 218
            |||.||....|:.:....|   |....||.   ||:         |....|......||.:.:  
plant   190 FGCEGGLMDTAFEHIKATG---GLTTESNY---PYK---------GEDATCNSKKTNPKATSI-- 237

  Fly   219 SGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEHGKELGG 283
            :||......|:         :..::.:..:.::.|...|.|    |...|..||:..|....| .
plant   238 TGYEDVPVNDE---------QALMKAVAHQPVSVGIEGGGF----DFQFYSSGVFTGECTTYL-D 288

  Fly   284 HAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QDHCGIESSISAGLPKL 340
            ||:..:|:|. ......||:|.|||.|.||:.|:.||.:.    |..||:  ::.|..|.:
plant   289 HAVTAIGYGE-STNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGL--AMKASYPTI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 9/38 (24%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 72/251 (29%)
SAG12NP_568651.1 Inhibitor_I29 38..95 CDD:214853 8/27 (30%)
Peptidase_C1 130..345 CDD:395062 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.