DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and RD21B

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_568620.1 Gene:RD21B / 834321 AraportID:AT5G43060 Length:463 Species:Arabidopsis thaliana


Alignment Length:329 Identity:86/329 - (26%)
Similarity:136/329 - (41%) Gaps:74/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIEVVRSKAKTWTVGRNFDASVTEGHIRRL-MGVHPDAHKFALPDKREV-LGDLYVNSV-DELPE 89
            ||:...:|..::.:|....|.:|....|.: :|        |.|.||.: ..|.|...| |.||:
plant    84 FIDEHNTKNLSYKLGLTRFADLTNEE
YRSMYLG--------AKPTKRVLKTSDRYQARVGDALPD 140

  Fly    90 EFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHT 151
            ..|.||:    ..:.:::|||||||||||   ||||.::.   |.:|..::  .|..:||.|..:
plant   141 SVDWRKE----GAVADVKDQGSCGSCWAFSTIGAVEGINK---IVTGDLIS--LSEQELVDCDTS 196

  Fly   152 CGFGCNGGFPGAAWSYWTRKGIV---SGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKC 213
            ...|||||....|:.:..:.|.:   :..||.:..|                  .|....:..|.
plant   197 YNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAADG------------------RCDQNRKNAKV 243

  Fly   214 SHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGP----VEGAFTVYEDLILYKDGVYQ 274
                   .|:|..:|         |..|.....::.:.:.|    :|.....::   ||..||:.
plant   244 -------VTIDSYED---------VPENSEASLKKALAHQPISVAIEAGGRAFQ---LYSSGVFD 289

  Fly   275 HEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQD----HCGIESSISA 335
            ...|.|| .|.:..:|:|.  |....||::.|||...||:.|:.::.|..:    .|||....|.
plant   290 GLCGTEL-DHGVVAVGYGT--ENGKDYWIVRNSWGNRWGESGYIKMARNIEAPTGKCGIAMEASY 351

  Fly   336 GLPK 339
            .:.|
plant   352 PIKK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/36 (22%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 68/261 (26%)
RD21BNP_568620.1 Inhibitor_I29 50..109 CDD:214853 6/24 (25%)
Peptidase_C1 138..353 CDD:278538 69/263 (26%)
GRAN 377..433 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.