DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and RD19

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_568052.1 Gene:RD19 / 830064 AraportID:AT4G39090 Length:368 Species:Arabidopsis thaliana


Alignment Length:379 Identity:95/379 - (25%)
Similarity:145/379 - (38%) Gaps:126/379 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPSLLS--DEFIEVVRSKAKTWTVGRNFD--ASVTEGHIRRL----------------------- 57
            ||.:|:  |.|....|...|.:......|  .||.:.::||.                       
plant    41 EPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRS 105

  Fly    58 ------MGVHPDAHKFALP---DKREVLGDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCG 113
                  :||...   |.||   :|..:|      ..:.|||:||    |.:...:..:::|||||
plant   106 EFRKKHLGVRSG---FKLPKDANKAPIL------PTENLPEDFD----WRDHGAVTPVKNQGSCG 157

  Fly   114 SCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCH--------TCGFGCNGGFPGAAWSYWTR 170
            |||:|.|..|:.....:.:|..|:  .|...||.|.|        :|..|||||...:|:.|..:
plant   158 SCWSFSATGALEGANFLATGKLVS--LSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLK 220

  Fly   171 KGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKS 235
            .|           |....|..|                      :..:.|.|....|.|...|.|
plant   221 TG-----------GLMKEEDYP----------------------YTGKDGKTCKLDKSKIVASVS 252

  Fly   236 -YSV-RRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEHGKELGG------------HAI 286
             :|| ..:..:|...::.|||:..|...         |..|    ..:||            |.:
plant   253 NFSVISIDEEQIAANLVKNGPLAVAINA---------GYMQ----TYIGGVSCPYICTRRLNHGV 304

  Fly   287 RILGWGVWG------EEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSIS 334
            .::|:|..|      :|| |||:|.|||...||::||::|.:|::.||::|.:|
plant   305 LLVGYGAAGYAPARFKEK-PYWIIKNSWGETWGENGFYKICKGRNICGVDSMVS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 12/72 (17%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 75/275 (27%)
RD19NP_568052.1 Inhibitor_I29 51..106 CDD:214853 8/54 (15%)
Peptidase_C1 135..359 CDD:395062 76/276 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.