DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and XCP1

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_567983.1 Gene:XCP1 / 829688 AraportID:AT4G35350 Length:355 Species:Arabidopsis thaliana


Alignment Length:323 Identity:83/323 - (25%)
Similarity:126/323 - (39%) Gaps:72/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IEVVRSKAKTWTVGRNFDASVTEGHIR-RLMGVHPDAHKFALPD---KREVLGDLYVNSVDELPE 89
            |:...::..::.:|.|..|.:|....: |.:|:       |.|.   ||:...:.....:.:||:
plant    82 IDQRNNEINSYWLGLNEFADLTHEE
FKGRYLGL-------AKPQFSRKRQPSANFRYRDITDLPK 139

  Fly    90 EFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGF 154
            ..|.||:....|    ::|||.|||||||..|.|:.....|.:|...:  .|..:|:.|..|...
plant   140 SVDWRKKGAVAP----VKDQGQCGSCWAFSTVAAVEGINQITTGNLSS--LSEQELIDCDTTFNS 198

  Fly   155 GCNGGFPGAAWSYWTRKGIVSGG--------PYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTP 211
            |||||....|:.|     |:|.|        ||...:|.       |:.             :..
plant   199 GCNGGLMDYAFQY-----IISTGGLHKEDDYPYLMEEGI-------CQE-------------QKE 238

  Fly   212 KCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVY-EDLILYKDGVYQH 275
            ....|..|||.              .|..|..|...:.:.:.||..|.... .|...||.||:..
plant   239 DVERVTISGYE--------------DVPENDDESLVKALAHQPVSVAIEASGRDFQFYKGGVFNG 289

  Fly   276 EHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QDHCGIESSIS 334
            :.|.:| .|.:..:|:|  ..:...|.::.|||...||:.||.|:.|.    :..|||....|
plant   290 KCGTDL-DHGVAAVGYG--SSKGSDYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKMAS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/35 (20%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/260 (27%)
XCP1NP_567983.1 Inhibitor_I29 51..106 CDD:214853 5/23 (22%)
Peptidase_C1 137..352 CDD:395062 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.