DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT4G23520

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_567686.2 Gene:AT4G23520 / 828452 AraportID:AT4G23520 Length:356 Species:Arabidopsis thaliana


Alignment Length:310 Identity:87/310 - (28%)
Similarity:130/310 - (41%) Gaps:54/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVN-SVDELPEEF 91
            ||:...:|..::.:|....|.:|....|.|....|...:..|...|.     ||. :.|:|||..
plant    78 FIDQHNAKNLSYQLGLTRFADLTVQE
YRDLFPGSPKPKQRNLKTSRR-----YVPLAGDQLPESV 137

  Fly    92 DSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGC 156
            |    |.....:.||:|||:|.|||||..|.|:.....|.:|..::  .|..:||. |:....||
plant   138 D----WRQEGAVSEIKDQGTCNSCWAFSTVAAVEGLNKIVTGELIS--LSEQELVD-CNLVNNGC 195

  Fly   157 NG-GFPGAAWSYW-TRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQS 219
            .| |....|:.:. ...|:.|...|       ||:         ||:..|   .|....|:   .
plant   196 YGSGLMDTAFQFLINNNGLDSEKDY-------PYQ---------GTQGSC---NRKQSTSN---K 238

  Fly   220 GYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYEDLILYKDGVYQHEHGKELGG 283
            ..|:|..:|         |..|.....::.:.:.||. |.....::.:||:..:|....|..| .
plant   239 VITIDSYED---------VPANDEISLQKAVAHQPVSVGVDKKSQEFMLYRSCIYNGPCGTNL-D 293

  Fly   284 HAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH----CGI 329
            ||:.|:|:|  .|....||::.|||.|.|||.|:.:|.|..:.    |||
plant   294 HALVIVGYG--SENGQDYWIVRNSWGTTWGDAGYIKIARNFEDPKGLCGI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 9/35 (26%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 72/249 (29%)
AT4G23520NP_567686.2 Inhibitor_I29 47..103 CDD:214853 6/24 (25%)
Peptidase_C1 133..349 CDD:278538 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.