DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT4G11320

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001328659.1 Gene:AT4G11320 / 826734 AraportID:AT4G11320 Length:371 Species:Arabidopsis thaliana


Alignment Length:403 Identity:97/403 - (24%)
Similarity:151/403 - (37%) Gaps:123/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLV----ATAASVAALTSGE-------PSLLSDEFIEVVRSKAKTWTV--GRNFDA------- 47
            ||.||    |||..::.::|.:       |......|........::|.|  |:.:|:       
plant    12 LLALVIASCATAMDMSVVSSNDNHHVTAGPGRRQGIFDAEATLMFESWMVKHGKVYDSVAEKERR 76

  Fly    48 -SVTEGHIR------------RL-------MGVH-------------PDAHKFALPDKREVLGDL 79
             ::.|.::|            ||       :.:|             |..|.|.....|....| 
plant    77 LTIFEDNLRFITNRNAENLSYRLGLNRFADLSLHEYGEICHGADPRPPRNHVFMTSSNRYKTSD- 140

  Fly    80 YVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFS 141
                .|.||:..|    |.|...:.|::|||.|.|||||   ||||.::.   |.:|..|.  .|
plant   141 ----GDVLPKSVD----WRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNK---IVTGELVT--LS 192

  Fly   142 ADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAH 206
            ..||:: |:....||.||....|:.:     |::.|..|::.. .||:.      :||.    ..
plant   193 EQDLIN-CNKENNGCGGGKVETAYEF-----IMNNGGLGTDND-YPYKA------LNGV----CE 240

  Fly   207 GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYS-------VRRNVREIQEEIMTNGPVEGAFTVYED 264
            |.......:|...||....|.|:....|:.:       |..:.||.|                  
plant   241 GRLKEDNKNVMIDGYENLPANDEAALMKAVAHQPVTAVVDSSSREFQ------------------ 287

  Fly   265 LILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QD 325
              ||:.||:....|..| .|.:.::|:|.  |....||::.||....||:.|:.::.|.    :.
plant   288 --LYESGVFDGTCGTNL-NHGVVVVGYGT--ENGRDYWIVKNSRGDTWGEAGYMKMARNIANPRG 347

  Fly   326 HCGIESSISAGLP 338
            .|||  ::.|..|
plant   348 LCGI--AMRASYP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 11/81 (14%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 69/261 (26%)
AT4G11320NP_001328659.1 Inhibitor_I29 56..111 CDD:214853 8/54 (15%)
Peptidase_C1 144..359 CDD:278538 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.