DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT4G11310

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_567376.1 Gene:AT4G11310 / 826733 AraportID:AT4G11310 Length:364 Species:Arabidopsis thaliana


Alignment Length:397 Identity:100/397 - (25%)
Similarity:153/397 - (38%) Gaps:115/397 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLV-------ATAASVAALTSGEPSLLSDEFIEVVRSKAKTWTV--GRNFDASVTEGHIRRLM 58
            |:|||       |||..::.::..:.:.|...|........::|.|  |:.: .||.|.. |||.
plant     9 LILLVAMVIASCATAIDMSVVSYDDNNRLHSVFDAEASLIFESWMVKHGKVY-GSVAEKE-RRLT 71

  Fly    59 GVHPDAHKF---------------------ALPDKREVL----------------GDLYVNSVDE 86
             :..|..:|                     :|.:.:||.                .|.|..|.|:
plant    72 -IFEDNLRFINNRNAENLSYRLGLTGFADLSLHEYKEVCHGADPRPPRNHVFMTSSDRYKTSADD 135

  Fly    87 -LPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADDLVS 147
             ||:..|    |.|...:.|::|||.|.|||||   ||||.::.   |.:|..|.  .|..||::
plant   136 VLPKSVD----WRNEGAVTEVKDQGHCRSCWAFSTVGAVEGLNK---IVTGELVT--LSEQDLIN 191

  Fly   148 CCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPK 212
             |:....||.||....|:.:     |:..|..|::.. .||:.      |||.    ..|.....
plant   192 -CNKENNGCGGGKLETAYEF-----IMKNGGLGTDND-YPYKA------VNGV----CDGRLKEN 239

  Fly   213 CSHVCQSGYTVDYAKDKHFGSKSYS-------VRRNVREIQEEIMTNGPVEGAFTVYEDLILYKD 270
            ..:|...||....|.|:....|:.:       :..:.||.|                    ||:.
plant   240 NKNVMIDGYENLPANDESALMKAVAHQPVTAVIDSSSREFQ--------------------LYES 284

  Fly   271 GVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QDHCGIES 331
            ||:....|..| .|.:.::|:|.  |....|||:.||....||:.|:.::.|.    :..|||  
plant   285 GVFDGSCGTNL-NHGVVVVGYGT--ENGRDYWLVKNSRGITWGEAGYMKMARNIANPRGLCGI-- 344

  Fly   332 SISAGLP 338
            ::.|..|
plant   345 AMRASYP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 11/41 (27%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/261 (27%)
AT4G11310NP_567376.1 Inhibitor_I29 49..104 CDD:214853 12/57 (21%)
Peptidase_C1 137..352 CDD:395062 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.