DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT3G49340

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566920.1 Gene:AT3G49340 / 824096 AraportID:AT3G49340 Length:341 Species:Arabidopsis thaliana


Alignment Length:319 Identity:93/319 - (29%)
Similarity:139/319 - (43%) Gaps:62/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKA-KTWTVGRNFDASVTEGHIR-RLMG-VHPDA-HKFALPDKREVLGDLYVNSVDEL 87
            :|:|.:.... ||:|:..|..:.:|:...: |..| |.|:. .:.:..|..|.:...|.| |.|.
plant    64 KFVESINMNTNKTYTLDVNEFSDLTDEEFKARYTGLVVPEGMTRISTTDSHETVSFRYEN-VGET 127

  Fly    88 PEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTC 152
            .|..|    |.....:..::.|..||.||||.||.|:.....|.:|..|:  .|...|:. |.|.
plant   128 GESMD----WIQEGAVTSVKHQQQCGCCWAFSAVAAVEGMTKIANGELVS--LSEQQLLD-CSTE 185

  Fly   153 GFGCNGGFPGAAWSY-WTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHV 216
            ..||.||....|:.| ...:||.:...|       ||:         |.:..|       :.:|:
plant   186 NNGCGGGIMWKAFDYIKENQGITTEDNY-------PYQ---------GAQQTC-------ESNHL 227

  Fly   217 CQ---SGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAF--TVYEDLILYKDGVYQHE 276
            ..   |||.              :|.:|..|...:.::..||..|.  :.|| .|.|..|::..|
plant   228 AAATISGYE--------------TVPQNDEEALLKAVSQQPVSVAIEGSGYE-FIHYSGGIFNGE 277

  Fly   277 HGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH----CGIES 331
            .|.:| .||:.|:|:|| .||.|.|||:.|||...||::|:.||:|..|.    ||:.|
plant   278 CGTQL-THAVTIVGYGV-SEEGIKYWLLKNSWGESWGENGYMRIMRDVDSPQGMCGLAS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 11/39 (28%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 76/254 (30%)
AT3G49340NP_566920.1 Inhibitor_I29 35..92 CDD:400519 7/27 (26%)
Peptidase_C1 129..340 CDD:395062 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.