DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CEP2

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_680113.3 Gene:CEP2 / 823992 AraportID:AT3G48340 Length:361 Species:Arabidopsis thaliana


Alignment Length:320 Identity:83/320 - (25%)
Similarity:127/320 - (39%) Gaps:67/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEE 90
            ::|.::..::.|....|.|..      |.|.|.|....:.:|....:          ::.:||..
plant    83 NKFADLTINEF
KNAYTGSNIK------HHRMLQGPKRGSKQFMYDHE----------NLSKLPSS 131

  Fly    91 FDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFG 155
            .|.||:    ..:.||::||.|||||||..|.|:.....|.:...|:  .|..:||.|......|
plant   132 VDWRKK----GAVTEIKNQGKCGSCWAFSTVAAVEGINKIKTNKLVS--LSEQELVDCDTKQNEG 190

  Fly   156 CNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSG 220
            ||||....|:.:..:.|.:      :.:...|||                  |...||.....:|
plant   191 CNGGLMEIAFEFIKKNGGI------TTEDSYPYE------------------GIDGKCDASKDNG 231

  Fly   221 --YTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVYQHEHGKELG 282
              .|:|..:|         |..|......:.:.|.||..|... ..|...|.:||:....|.|| 
plant   232 VLVTIDGHED---------VPENDENALLKAVANQPVSVAIDAGSSDFQFYSEGVFTGSCGTEL- 286

  Fly   283 GHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQD----HCGIESSISAGLP 338
            .|.:..:|:|  .|....||::.|||..:||:.|:.:|.|..|    .|||  ::.|..|
plant   287 NHGVAAVGYG--SERGKKYWIVRNSWGAEWGEGGYIKIEREIDEPEGRCGI--AMEASYP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 8/37 (22%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/254 (28%)
CEP2NP_680113.3 Inhibitor_I29 38..93 CDD:400519 1/9 (11%)
Peptidase_C1 128..343 CDD:395062 74/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.