DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT3G43960

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566867.1 Gene:AT3G43960 / 823513 AraportID:AT3G43960 Length:376 Species:Arabidopsis thaliana


Alignment Length:249 Identity:74/249 - (29%)
Similarity:110/249 - (44%) Gaps:57/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADDLV 146
            |.||:|.|.|::....|   .::.||.|||||||   ||||.::.   |.:|..|:  .|..:|:
plant   125 DVLPDEVDWRERGAVVP---RVKRQGECGSCWAFAATGAVEGINQ---ITTGELVS--LSEQELI 181

  Fly   147 SCCH-TCGFGCNGGFPGAAWSYWTRK---GIVSGGPYG----SNQGCRPYEISPCEHHVNGTRPP 203
            .|.. ...|||.||  ||.|::...|   ||||...||    ....|:..|:             
plant   182 DCDRGNDNFGCAGG--GAVWAFEFIKENGGIVSDEVYGYTGEDTAACKAIEM------------- 231

  Fly   204 CAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILY 268
                 :|.:.  |..:|:.|....|:      .|:::.|......:|.:.         .::..|
plant   232 -----KTTRV--VTINGHEVVPVNDE------MSLKKAVAYQPISVMISA---------ANMSDY 274

  Fly   269 KDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR 322
            |.|||:.......|.|.:.|:|:|...:|. .||||.|||..:||:.|:.|:.|
plant   275 KSGVYKGACSNLWGDHNVLIVGYGTSSDEG-DYWLIRNSWGPEWGEGGYLRLQR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 72/246 (29%)
AT3G43960NP_566867.1 Inhibitor_I29 41..97 CDD:214853
Peptidase_C1 127..346 CDD:278538 73/247 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.