DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT3G19400

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566634.2 Gene:AT3G19400 / 821474 AraportID:AT3G19400 Length:362 Species:Arabidopsis thaliana


Alignment Length:377 Identity:99/377 - (26%)
Similarity:152/377 - (40%) Gaps:105/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLVATAASVAALTSGEPSLLSDEFIEVVRSKAKTWTV--GRNFDASVTEGHIRRLMGVHPDAHK 66
            :||::::..||..|..|.:...      ||...:.|.|  .:|::..   |...|...:..|..|
plant    18 VLLLSSSLGVATETEIERNETE------VRLMYEQWLVENRKNYNGL---GEKERRFKIFKDNLK 73

  Fly    67 F-----ALPDKREVLG-----DL--------YV--------NSV----------DELPEEFDSRK 95
            |     ::||:...:|     ||        |:        :||          |.||:|.|   
plant    74 FVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKTERYLYKEGDVLPDEVD--- 135

  Fly    96 QWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGF---GCN 157
             |.....:..::|||:|||||||.||.|:.....|.:|..::  .|..:||.|..  ||   ||:
plant   136 -WRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELIS--LSEQELVDCDR--GFVNAGCD 195

  Fly   158 GGFPGAAWSYWTRKGIVSGG---PYGSNQGCRPYEISPCE-HHVNGTRPPCAHGGRTPKCSHVCQ 218
            ||....|:.:..:.|.:...   ||.:|      ::..|. ...|.||.                
plant   196 GGIMNYAFEFIMKNGGIETDQDYPYNAN------DLGLCNADKNNNTRV---------------- 238

  Fly   219 SGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLI-LYKDGVYQHEHGKELG 282
              .|:|..:|         |.|:..:..::.:.:.||..|........ |||.||.....|..| 
plant   239 --VTIDGYED---------VPRDDEKSLKKAVAHQPVSVAIEASSQAFQLYKSGVMTGTCGISL- 291

  Fly   283 GHAIRILGWG-VWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQD----HCGI 329
            .|.:.::|:| ..||:   ||:|.|||..:|||.|:.::.|..|    .|||
plant   292 DHGVVVVGYGSTSGED---YWIIRNSWGLNWGDSGYVKLQRNIDDPFGKCGI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/41 (17%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 73/255 (29%)
AT3G19400NP_566634.2 Inhibitor_I29 44..100 CDD:214853 13/58 (22%)
Peptidase_C1 130..348 CDD:395062 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.