DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT3G19390

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_566633.1 Gene:AT3G19390 / 821473 AraportID:AT3G19390 Length:452 Species:Arabidopsis thaliana


Alignment Length:319 Identity:81/319 - (25%)
Similarity:132/319 - (41%) Gaps:74/319 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKRE-----VLGDLYVNSV-DELPEEFDSRK 95
            :|:.||....|.:|....|.:.          |..|.|     |.|:.|:..| |.||:..|   
plant    83 RTYEVGLTRFADLTNDE
FRAIY----------LRSKMERTRVPVKGEKYLYKVGDSLPDAID--- 134

  Fly    96 QWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGF 160
             |.....:..::|||||||||||.|:.|:.....|.:|..::  .|..:||.|..:...||.||.
plant   135 -WRAKGAVNPVKDQGSCGSCWAFSAIGAVEGINQIKTGELIS--LSEQELVDCDTSYNDGCGGGL 196

  Fly   161 PGAAWSYWTRKGIVSGGPYGSNQGCRPY---EISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYT 222
            ...|:.:     |:..|...:.:. .||   :::.|......||.                  .|
plant   197 MDYAFKF-----IIENGGIDTEED-YPYIATDVNVCNSDKKNTRV------------------VT 237

  Fly   223 VDYAKDKHFGSKSYSVRRNVREIQEEIMTNGP----VEGAFTVYEDLILYKDGVYQHEHGKELGG 283
            :|..:|         |.:|..:..::.:.|.|    :|.....::   ||..||:....|..| .
plant   238 IDGYED---------VPQNDEKSLKKALANQPISVAIEAGGRAFQ---LYTSGVFTGTCGTSL-D 289

  Fly   284 HAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR----GQDHCGIESSISAGLP 338
            |.:..:|:|..|.:  .||::.|||.::||:.|:|::.|    ....||:  ::.|..|
plant   290 HGVVAVGYGSEGGQ--DYWIVRNSWGSNWGESGYFKLERNIKESSGKCGV--AMMASYP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/26 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 64/258 (25%)
AT3G19390NP_566633.1 Inhibitor_I29 43..99 CDD:214853 5/15 (33%)
Peptidase_C1 129..345 CDD:278538 67/263 (25%)
GRAN 364..420 CDD:197621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.