DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT2G34080

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_565780.1 Gene:AT2G34080 / 817969 AraportID:AT2G34080 Length:345 Species:Arabidopsis thaliana


Alignment Length:313 Identity:78/313 - (24%)
Similarity:115/313 - (36%) Gaps:54/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKA-KTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEE 90
            :|||....|. |::.:|.|..|..|.   ...:.:|............:|:.....:....:.:.
plant    68 KFIENFNKKGNKSYKLGVNEFADWTN---EE
FLAIHTGLKGLTEVSPSKVVAKTISSQTWNVSDM 129

  Fly    91 FDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFG 155
            ....|.|.....:..::.||.||.||||.||.|:.....|..|..|:  .|...|:.|......|
plant   130 VVESKDWRAEGAVTPVKYQGQCGCCWAFSAVAAVEGVAKIAGGNLVS--LSEQQLLDCDREYDRG 192

  Fly   156 CNGGFPGAAWSYWTR-KGIVSGGPY---GSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHV 216
            |:||....|::|..: :||.|...|   ||:.|||           :..||.....|        
plant   193 CDGGIMSDAFNYVVQNRGIASENDYSYQGSDGGCR-----------SNARPAARISG-------- 238

  Fly   217 CQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYED-LILYKDGVYQHEHGKE 280
                              ..:|..|......|.::..||..:.....| .:.|..|||....|..
plant   239 ------------------FQTVPSNNERALLEAVSRQPVSVSMDATGDGFMHYSGGVYDGPCGTS 285

  Fly   281 LGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QDHCGI 329
             ..||:..:|:|. .::...|||..|||...||:.|:.||.|.    |..||:
plant   286 -SNHAVTFVGYGT-SQDGTKYWLAKNSWGETWGEKGYIRIRRDVAWPQGMCGV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/37 (27%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 67/251 (27%)
AT2G34080NP_565780.1 Inhibitor_I29 39..95 CDD:214853 9/29 (31%)
Peptidase_C1 132..344 CDD:395062 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.