DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT2G27420

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_565649.1 Gene:AT2G27420 / 817287 AraportID:AT2G27420 Length:348 Species:Arabidopsis thaliana


Alignment Length:320 Identity:86/320 - (26%)
Similarity:127/320 - (39%) Gaps:61/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKAK-TWTVGRNFDASVTEGHIRRLMGVH-----PDA--HKFALPDKREVLGDLYVNS 83
            ||::......| |:.|..|..:.:|:...|   ..|     |:|  ....|...:..:...|.| 
plant    64 EFVQNFNMNNKITYKVDINEFSDLTDEEFR---ATHTGLVVPEAITRISTLSSGKNTVPFRYGN- 124

  Fly    84 VDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSC 148
            |.:..|..|.|::....|    ::.||.||.||||.||.|:.....|..|..|:  .|...|:.|
plant   125 VSDNGESMDWRQEGAVTP----VKYQGRCGGCWAFSAVAAVEGITKITKGELVS--LSEQQLLDC 183

  Fly   149 CHTCGFGCNGGFPGAAWSYWTR-KGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPK 212
            ......||.||....|:.|..: :||.:...|       ||:.|                     
plant   184 DRDYNQGCRGGIMSKAFEYIIKNQGITTEDNY-------PYQES--------------------- 220

  Fly   213 CSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPV----EGAFTVYEDLILYKDGVY 273
             ...|.|..|:..:......|...:|..|..|...:.::..||    ||....:..   |..||:
plant   221 -QQTCSSSTTLSSSFRAATISGYETVPMNNEEALLQAVSQQPVSVGIEGTGAAFRH---YSGGVF 281

  Fly   274 QHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRG----QDHCGI 329
            ..|.|.:| .||:.|:|:|: .||...||::.|||...||::|:.||.|.    |..||:
plant   282 NGECGTDL-HHAVTIVGYGM-SEEGTKYWVVKNSWGETWGENGYMRIKRDVDAPQGMCGL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/42 (24%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/251 (28%)
AT2G27420NP_565649.1 Inhibitor_I29 35..91 CDD:214853 7/26 (27%)
Peptidase_C1 130..347 CDD:278538 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.