DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT2G22160

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_179806.1 Gene:AT2G22160 / 816750 AraportID:AT2G22160 Length:105 Species:Arabidopsis thaliana


Alignment Length:87 Identity:17/87 - (19%)
Similarity:37/87 - (42%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHK-FALPDKREVLGD--LYVNSVDELP 88
            |:|.....:.|.:.:..|..|::|:...       .:||. |.:.|.:::|..  .:..::.:.|
plant    23 EYIVKTNKERKPYKLKLNKFANLTDVEF
-------VNAHTCFDMSDHKKILDSKPFFYENMTQAP 80

  Fly    89 EEFDSRKQWPNCPTIGEIRDQG 110
            :..|    |.....:..::|||
plant    81 DSLD----WREKGAVTNVKDQG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/36 (17%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 6/23 (26%)
AT2G22160NP_179806.1 Inhibitor_I29 <15..50 CDD:304561 6/26 (23%)
Peptidase_C1 79..>98 CDD:304901 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.