DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and AT2G21430

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_565512.1 Gene:AT2G21430 / 816682 AraportID:AT2G21430 Length:361 Species:Arabidopsis thaliana


Alignment Length:338 Identity:87/338 - (25%)
Similarity:139/338 - (41%) Gaps:108/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALP---DKREVLGDLYVNSVDELP 88
            :|.::.||:.:                 |:.:||...   |.||   ::..:|      ....||
plant    95 QFSDLTRSE
FR-----------------RKHLGVKGG---FKLPKDANQAPIL------PTQNLP 133

  Fly    89 EEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCH--- 150
            ||||    |.:...:..:::||||||||:|....|:.....:.:|..|:  .|...||.|.|   
plant   134 EEFD----WRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVS--LSEQQLVDCDHECD 192

  Fly   151 -----TCGFGCNGGFPGAAWSYWTRK-GIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGR 209
                 :|..|||||...:|:.|..:. |::....|       ||         .||     .||.
plant   193 PEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDY-------PY---------TGT-----DGGS 236

  Fly   210 TPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQ 274
                   |:    :|.:|.....|....|..|..:|...::.|||:..|.          :..|.
plant   237 -------CK----LDRSKIVASVSNFSVVSINEDQIAANLIKNGPLAVAI----------NAAYM 280

  Fly   275 HEHGKELGG------------HAIRILGWGVWG------EEKIPYWLIGNSWNTDWGDHGFFRIL 321
            ..:   :||            |.:.::|:|..|      :|| |||:|.|||...||::||::|.
plant   281 QTY---IGGVSCPYICSRRLNHGVLLVGYGSAGFSQARLKEK-PYWIIKNSWGESWGENGFYKIC 341

  Fly   322 RGQDHCGIESSIS 334
            :|::.||::|.:|
plant   342 KGRNICGVDSLVS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/36 (17%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 76/274 (28%)
AT2G21430NP_565512.1 Inhibitor_I29 48..103 CDD:214853 2/7 (29%)
Peptidase_C1 132..356 CDD:395062 77/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.