DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsw

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001039033.1 Gene:ctsw / 733785 XenbaseID:XB-GENE-963153 Length:303 Species:Xenopus tropicalis


Alignment Length:269 Identity:70/269 - (26%)
Similarity:107/269 - (39%) Gaps:83/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVS 147
            |.:.||  |.:...|.....|.:.::|.:|.|||||.||..:..:..| .|..::.   ::..|.
 Frog    73 SEEVLP--FPTSCDWRTQNVISKAKNQRTCHSCWAFAAVANIEAQWAI-LGQTISL---SEQQVI 131

  Fly   148 CCHTCGFGCNGGFPGAAW-SYWT---RKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHG- 207
            .|:||..||:||:   || ::.|   :.|:.|...|            |...||:.    |..| 
 Frog   132 DCNTCRNGCSGGY---AWDAFMTVLQQGGLTSEKSY------------PYTGHVSN----CRKGF 177

  Fly   208 --------------GRTPKCSHVCQSG---YTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPV 255
                          ..|...|||...|   .|::.|..||:          .:.|.:.:.:|...
 Frog   178 EAVGWIHDFEMLKKNETAMASHVAHKGTLTVTINKAPLKHY----------QKGIVDTLRSNCDP 232

  Fly   256 EGAFTVYEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRI 320
            .           |.|             |.:.|:|:.  |..|:|.|::.|||..|||:.||||:
 Frog   233 N-----------YVD-------------HVVLIVGYR--GGGKLPQWILKNSWGEDWGEKGFFRM 271

  Fly   321 LRGQDHCGI 329
            .|.::.|||
 Frog   272 FRDKNACGI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 68/264 (26%)
ctswNP_001039033.1 Inhibitor_I29 1..53 CDD:214853
Peptidase_C1A 80..285 CDD:239068 66/260 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.