DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Cts8

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001121688.1 Gene:Cts8 / 680718 RGDID:1588248 Length:333 Species:Rattus norvegicus


Alignment Length:325 Identity:80/325 - (24%)
Similarity:136/325 - (41%) Gaps:60/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GEPSLLSDEFIEVVR-------SKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVL 76
            |:...:.:|.::||:       .:.|.:|:..|..|.:|....|::|...|..:   |..|:.:.
  Rat    46 GQKRAVWEENMKVVKQHNIEYDQEKKNFTMELNAFADMTGEEFRKMMTNIPVQN---LRKKKSIH 107

  Fly    77 GDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFS 141
            ..::    ..||:..|    |.....:..:::||:|.|||||....|:..::...:|..|:  .|
  Rat   108 QPIF----RYLPKFVD----WRRRGYVTSVKNQGTCNSCWAFSVAGAIEGQMFRKTGRLVS--LS 162

  Fly   142 ADDLVSCCHTCG-FGCNGGFPGAAWSY-WTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPC 204
            ..:||.|....| .||:.|....|..| |:..|:.:...|       |||         |...||
  Rat   163 PQNLVDCSRPEGNHGCHMGSTLYALKYVWSNGGLEAESTY-------PYE---------GKEGPC 211

  Fly   205 AHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYEDLILY 268
            .:   .|:.|....:|::              :|.|:...:...:.|.||:. |....:.....|
  Rat   212 RY---LPRRSAARVTGFS--------------TVARSEEALMHAVATIGPISVGIDASHVSFRFY 259

  Fly   269 KDGVYQHEH-GKELGGHAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFRILRG-QDHCGI 329
            :.|:|.... ......|::.::|:|..|.|.  ..||||.||....||.:|:.::.|| .:||||
  Rat   260 RRGIYYEPRCSSNRINHSVLVVGYGYEGRESDGRKYWLIKNSHGVGWGMNGYMKLARGWNNHCGI 324

  Fly   330  329
              Rat   325  324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 11/46 (24%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 65/249 (26%)
Cts8NP_001121688.1 PTZ00203 5..327 CDD:185513 80/325 (25%)
Inhibitor_I29 29..87 CDD:214853 9/40 (23%)
Peptidase_C1A 115..331 CDD:239068 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.