DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Tpbpa

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_742070.1 Gene:Tpbpa / 64509 RGDID:621454 Length:124 Species:Rattus norvegicus


Alignment Length:111 Identity:27/111 - (24%)
Similarity:46/111 - (41%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLVATAASVAALT-----------SGEPSLLSDEFIEVVR---SKAKTWTVGRNFDAS----V 49
            |.|.||:||.:...|           .|....:.|||::.|:   ||:.......:.:.|    :
  Rat    10 LCLGVASAAILPDTTLYAELQEQKGKEGFRKAVWDEFMKTVKLYNSKSDQEEEELDIEMSALSEL 74

  Fly    50 TEGHIRRLMGVHPDAHKFALPDKREV--LGDL-----YVNSVDELP 88
            |:....::|  ...:|..:..|:.:.  |||:     .|.|.||:|
  Rat    75 TDEDFMKIM--TSISHSMSGEDENQAQSLGDVPEFEDLVESGDEIP 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 9/46 (20%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 1/1 (100%)
TpbpaNP_742070.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.