DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and zgc:174855

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001096592.1 Gene:zgc:174855 / 569326 ZFINID:ZDB-GENE-071004-74 Length:335 Species:Danio rerio


Alignment Length:308 Identity:78/308 - (25%)
Similarity:127/308 - (41%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TWTVGRNFDASVTEGHIRRLM-GVHPDAHKFALPDKREVLGDLYVN-SVDELPEEFDSRKQWPNC 100
            |:.:|.|....:|....|:.| |...|.:       |...|.|::. |....|::.|    |...
Zfish    71 TFKMGMNQFGDMTNEE
FRQAMNGYKQDPN-------RTSKGALFMEPSFFAAPQQVD----WRQR 124

  Fly   101 PTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAA 164
            ..:..::||..|||||:|.:..|:..::...:|..::  .|..:||.|....| .|||||....|
Zfish   125 GYVTPVKDQKQCGSCWSFSSTGALEGQLFRKTGKLIS--MSEQNLVDCSRPQGNQGCNGGIMDQA 187

  Fly   165 WSY-WTRKGIVSGGPYGSNQGCRPY---EISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDY 225
            :.| ...||:.|...|       ||   :..||.:              .|:.:....:|: ||.
Zfish   188 FQYVKENKGLDSEQSY-------PYLARDDLPCRY--------------DPRFNVAKITGF-VDI 230

  Fly   226 AKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGVYQHEHGKELGGHAIRIL 289
            .            |.|...:...:...|||..|... ::.|..|:.|:|..........||:.::
Zfish   231 P------------RGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACTSRLDHAVLVV 283

  Fly   290 GWGVWGEEKI--PYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIESSIS 334
            |:|..|.:..  .||::.|||:..|||.|:..:.:.: :||||.:..|
Zfish   284 GYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGIATMAS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/26 (27%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 66/256 (26%)
zgc:174855NP_001096592.1 Inhibitor_I29 28..86 CDD:214853 4/14 (29%)
Peptidase_C1 115..334 CDD:278538 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.