DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and wu:fa26c03

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001098585.1 Gene:wu:fa26c03 / 564979 ZFINID:ZDB-GENE-030131-5289 Length:336 Species:Danio rerio


Alignment Length:309 Identity:78/309 - (25%)
Similarity:129/309 - (41%) Gaps:59/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TWTVGRNFDASVTEGHIRRLM-GVHPDAHKFALPDKREVLGDLYVN-SVDELPEEFDSRKQWPNC 100
            |:.:|.|....:|....|:.| |...|.:       |...|.|::. |....|::.|    |...
Zfish    71 TFKMGMNQFGDMTNEE
FRQAMNGYKHDPN-------RTSQGPLFMEPSFFAAPQQVD----WRQR 124

  Fly   101 PTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAA 164
            ..:..::||..|||||:|.:..|:..::...:|..::  .|..:||.|....| .|||||....|
Zfish   125 GFVTPVKDQKQCGSCWSFSSTGALEGQLFRKTGKLIS--MSEQNLVDCSRPQGNQGCNGGLMDQA 187

  Fly   165 WSY-WTRKGIVSGGPYGSNQGCRPY---EISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDY 225
            :.| ...||:.|...|       ||   :..||.:              .|:.:....:|: ||.
Zfish   188 FQYVKENKGLDSEQSY-------PYLARDDLPCRY--------------DPRFNVAKITGF-VDI 230

  Fly   226 AKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKDGV-YQHEHGKELGGHAIRI 288
            .            |.|...:...:...|||..|... ::.|..|:.|: |:.........||:.:
Zfish   231 P------------RGNELALMNAVAAVGPVSVAIDASHQSLQFYQSGIYYERACSSSRLDHAVLV 283

  Fly   289 LGWGVWGEEKI--PYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIESSIS 334
            :|:|..|.:..  .||::.|||:..|||.|:..:.:.: :|||:.:|.|
Zfish   284 VGYGYQGADVAGNRYWIVKNSWSDKWGDKGYIYMAKDKNNHCGVATSAS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/26 (27%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 66/257 (26%)
wu:fa26c03NP_001098585.1 Inhibitor_I29 28..86 CDD:214853 4/14 (29%)
Peptidase_C1 115..335 CDD:278538 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.