DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsf

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_063914.1 Gene:Ctsf / 56464 MGIID:1861434 Length:462 Species:Mus musculus


Alignment Length:267 Identity:65/267 - (24%)
Similarity:111/267 - (41%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SVDEL-PEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLV 146
            |:::| |.|:|.||:    ..:.|:::||.|||||||.....:..:..::.|..::  .|..:|:
Mouse   244 SINDLAPPEWDWRKK----GAVTEVKNQGMCGSCWAFSVTGNVEGQWFLNRGTLLS--LSEQELL 302

  Fly   147 SCCHTCGFGCNGGFPGAAW-SYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRT 210
            . |......|.||.|..|: :.....|:.:...||                         :.|..
Mouse   303 D-CDKVDKACLGGLPSNAYAAIKNLGGLETEDDYG-------------------------YQGHV 341

  Fly   211 PKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQH 275
            ..|:...|..        |.:.:.|..:.||..:|...:...||:..|...:        |:..:
Mouse   342 QTCNFSAQMA--------KVYINDSVELSRNENKIAAWLAQKGPISVAINAF--------GMQFY 390

  Fly   276 EHG-----KELGG-----HAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIE 330
            .||     :.|..     ||:.::|:|  ....||||.|.|||.:|||:.|::.:.||...||:.
Mouse   391 RHGIAHPFRPLCSPWFIDHAVLLVGYG--NRSNIPYWAIKNSWGSDWGEEGYYYLYRGSGACGVN 453

  Fly   331 SSISAGL 337
            :..|:.:
Mouse   454 TMASSAV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 63/258 (24%)
CtsfNP_063914.1 Inhibitor_I29 165..221 CDD:214853
Peptidase_C1 249..460 CDD:278538 63/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.