DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Cts7

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001346316.1 Gene:Cts7 / 56092 MGIID:1860262 Length:331 Species:Mus musculus


Alignment Length:256 Identity:72/256 - (28%)
Similarity:113/256 - (44%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCH 150
            ::|...|.||:....|    :|.|||||:|||| :|.|..:.......||: ...|..:|:.|..
Mouse   111 KIPPTLDWRKEGYVTP----VRRQGSCGACWAF-SVTACIEGQLFKKTGKL-IPLSVQNLMDCSV 169

  Fly   151 TCGF-GCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCS 214
            :.|. ||:||.|..|:.|....|.:..      :...|||                     .|..
Mouse   170 SYGTKGCDGGRPYDAFQYVKNNGGLEA------EATYPYE---------------------AKAK 207

  Fly   215 HVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGP----VEGAFTVYEDLILYKDGVYQH 275
            | |:........|...|    :.|.||...:.:.::|:||    ::|:...:..   |:.|:| |
Mouse   208 H-CRYRPERSVVKVNRF----FVVPRNEEALLQALVTHGPIAVAIDGSHASFHS---YRGGIY-H 263

  Fly   276 EH--GKELGGHAIRILGWGVWG--EEKIPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIES 331
            |.  .|:...|.:.::|:|..|  .|...|||:.||....||::|:.::.||| ::|||.|
Mouse   264 EPKCRKDTLDHGLLLVGYGYEGHESENRKYWLLKNSHGERWGENGYMKLPRGQNNYCGIAS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 72/254 (28%)
Cts7NP_001346316.1 Inhibitor_I29 29..87 CDD:214853
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18776147 33..50
Peptidase_C1A 113..329 CDD:239068 72/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.