DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsk

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001017778.1 Gene:ctsk / 550475 ZFINID:ZDB-GENE-001205-4 Length:333 Species:Danio rerio


Alignment Length:332 Identity:95/332 - (28%)
Similarity:142/332 - (42%) Gaps:68/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TSGEPSLLSDEFIEVVRSKAK----TWTVGRNFDASVT-EGHIRRLMG----VHPDAHKFALPDK 72
            |..|.::|   |||....:.:    |:.:|.|....:| |....::||    ::.|.....:||.
Zfish    52 TIWEKNML---FIEAHNKEYELGIHTYDLGMNHFGDMTLEEVAEKVMGLQMPMYRDPANTFVPDD 113

  Fly    73 REVLGDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVN 137
            |          |.:||:..|.||    ...:..:::||||||||||.:|.|:..::....|..|:
Zfish   114 R----------VGKLPKSIDYRK----LGYVTSVKNQGSCGSCWAFSSVGALEGQLMKTKGQLVD 164

  Fly   138 FHFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRP 202
              .|..:||.|. |...||.||:...|:.|           ..:|||....|..|   :| ||..
Zfish   165 --LSPQNLVDCV-TENDGCGGGYMTNAFRY-----------VSNNQGIDSEESYP---YV-GTDQ 211

  Fly   203 PCAH--GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYED 264
            .||:  .|....|     .||     |:...|        |.|.:...:...|||. |...:...
Zfish   212 QCAYNTSGVAASC-----RGY-----KEIPQG--------NERALTAAVANVGPVSVGIDAMQST 258

  Fly   265 LILYKDGVYQHEH-GKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH-C 327
            .:.||.|||...: .||...||:..:|:|.....| .||::.|||..:||..|:..:.|.::: |
Zfish   259 FLYYKSGVYYDPNCNKEDVNHAVLAVGYGATPRGK-KYWIVKNSWGEEWGKKGYVLMARNRNNAC 322

  Fly   328 GIESSIS 334
            ||.:..|
Zfish   323 GIANLAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 11/48 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 76/252 (30%)
ctskNP_001017778.1 Inhibitor_I29 30..89 CDD:214853 10/39 (26%)
Peptidase_C1 118..332 CDD:278538 77/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.