DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and tspan1

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001016107.1 Gene:tspan1 / 548861 XenbaseID:XB-GENE-868363 Length:245 Species:Xenopus tropicalis


Alignment Length:92 Identity:21/92 - (22%)
Similarity:28/92 - (30%) Gaps:29/92 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 HTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCS 214
            |.|||.....|..:.:             |.:|....|   |.|.:..:.....|...|...  |
 Frog   149 HCCGFNNYTDFSNSTF-------------YNNNHQQYP---SYCCNSTSSANSVCTQQGAMN--S 195

  Fly   215 HVCQSGYTVDYAKDKHFGSKSYSVRRN 241
            ||  ||.         |....|.:|:|
 Frog   196 HV--SGC---------FSQLIYLIRQN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 21/92 (23%)
tspan1NP_001016107.1 Tetraspannin 7..236 CDD:366035 21/92 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.