DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsll3

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006253592.1 Gene:Ctsll3 / 498691 RGDID:1560071 Length:330 Species:Rattus norvegicus


Alignment Length:366 Identity:92/366 - (25%)
Similarity:147/366 - (40%) Gaps:72/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLLLLVAT--AASVAALTSGEPSLLSDEFIEVVRSK-AKTWTVGRNFDASVTEGHIRRLMGVHP 62
            |..:.|:||  ...::|..:.:||.  |...|..::| .||:.............:..:::.:|.
  Rat     1 MTPIFLLATLCLGMISAAPTHDPSF--DTVWEEWKTKHGKTYNTNEEGQKRAVWENNMKMINLHN 63

  Fly    63 D-----AHKFALPDKREVLGDLYVNSVDELPEEFDSRK-------------------QWPNCPTI 103
            :     .|.|:|  :....|||......||...|..:|                   .|.....:
  Rat    64 EDYLKGKHGFSL--EMNAFGDLTNTEFRELMTGFQGQKTKMMKVFPEPFLGDVPKTVDWRKHGYV 126

  Fly   104 GEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAAWSY 167
            ..:::||.|||||||.||.::..:|...:|..|  ..|..:||.|..:.| .||:||.|..|:.|
  Rat   127 TPVKNQGPCGSCWAFSAVGSLEGQVFRKTGKLV--PLSEQNLVDCSWSHGNKGCDGGLPDFAFQY 189

  Fly   168 -WTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHF 231
             ....|:.:...|       |||.      :|||                |:  |...|:..|..
  Rat   190 VKDNGGLDTSVSY-------PYEA------LNGT----------------CR--YNPKYSAAKVV 223

  Fly   232 GSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYEDLILYKDGVYQHEHGKELG-GHAIRILGWGVW 294
            |..|.....|.  :.:.:.|.||:. |....::....||.|:|......... .||:.::|:|..
  Rat   224 GFMSIPPSENA--LMKAVATVGPISVGIDIKHKSFQFYKGGMYYEPDCSSTNLNHAVLVVGYGEE 286

  Fly   295 GEEKIPYWLIGNSWNTDWGDHGFFRILRG-QDHCGIESSIS 334
            .:.: .|||:.|||..|||..|:.::.:. .::|||.|..|
  Rat   287 SDGR-KYWLVKNSWGRDWGMDGYIKMAKDWNNNCGIASDAS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/45 (13%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/271 (26%)
Ctsll3XP_006253592.1 Inhibitor_I29 29..87 CDD:214853 11/59 (19%)
Peptidase_C1 114..329 CDD:278538 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.