DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctla2a

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006253587.1 Gene:Ctla2a / 498690 RGDID:1565540 Length:188 Species:Rattus norvegicus


Alignment Length:108 Identity:25/108 - (23%)
Similarity:35/108 - (32%) Gaps:22/108 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VGRNFDASVTEGHIRR-----LMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFDSRKQW--- 97
            :|.|..:.:|....||     ||......|...:|:      ||..||  .|..|.|....|   
  Rat    62 MGLNQFSDLTTEE
FRRNCCGSLMCRGKTTHDLPIPE------DLGKNS--SLTPERDQINLWNLT 118

  Fly    98 -PNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFH 139
             |..|....:|...|.|.     ...:..:|......|.::.|
  Rat   119 LPCSPASSLLRTSESVGR-----VSHSKHNRSLTQPAGAISMH 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/27 (26%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 11/56 (20%)
Ctla2aXP_006253587.1 Inhibitor_I29 16..74 CDD:214853 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.