DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsz

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:278 Identity:75/278 - (26%)
Similarity:116/278 - (41%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SVDELPEEFDSRKQWPNCPTIGEI---RDQ---GSCGSCWAFGAVEAMSDRVCI-HSGGKVNFHF 140
            ::.|||:|:|    |.|...:..:   |:|   ..||||||.|:..|::||:.| ......:.:.
Zfish    50 NLKELPKEWD----WRNIKGVNYVSTTRNQHIPQYCGSCWAHGSTSALADRINIKRKAAWPSAYL 110

  Fly   141 SADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGI---VSGGPYGSNQGCRPYEISPCEHHVNGTRP 202
            |..:::. |...| .|:||.....|.|...|||   ........:|.|:|:  :.|     ||  
Zfish   111 SVQNVID-CGDAG-SCSGGDHSGVWEYAHNKGIPDETCNNYQAKDQDCKPF--NQC-----GT-- 164

  Fly   203 PCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLIL 267
             |...|       ||.........|...:||.|     .:.:::.||.:.||:.......:.|..
Zfish   165 -CTTFG-------VCNIVKNFTLWKVGDYGSAS-----GLDKMKAEIYSGGPISCGIMATDKLDA 216

  Fly   268 YKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR--------GQ 324
            |..|:|.....:....|.:.:.|||| .|..:.:|::.|||...||:.|:.||:.        .|
Zfish   217 YTGGLYSEYVQEPYINHIVSVAGWGV-DENGVEFWVVRNSWGEPWGEKGWLRIVTSAYKGGSGSQ 280

  Fly   325 DHCGIESSISAG---LPK 339
            .:..||.....|   |||
Zfish   281 YNLAIEEDCMYGDPILPK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 69/265 (26%)
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 71/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.