DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsll

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_005165198.1 Gene:ctsll / 449826 ZFINID:ZDB-GENE-041010-76 Length:337 Species:Danio rerio


Alignment Length:329 Identity:86/329 - (26%)
Similarity:137/329 - (41%) Gaps:62/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EPSLLSDEFIEVVRSKAK-TWTVGRNFDASVTEGHIRRLM-GVHPDAHKFALPDKREVLGDLYVN 82
            |.:|...|...:..|..| |:.:|.|....:|....|:.| |.:.|.:       |:..|.|::.
Zfish    53 EKNLKKIELHNLEHSVGKHTFRLGMNQFGDMTNEEFRQAMNGYNRDPN-------RKSKGSLFIE 110

  Fly    83 -SVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLV 146
             |....|::.|    |.....:..|:||..|||||||.:..|:..:|...:|..|:  .|..:|:
Zfish   111 PSFFTAPQQID----WRQKGYVTPIKDQKRCGSCWAFSSTGALEGQVFRKTGKLVS--LSEQNLM 169

  Fly   147 SCCHTCG-FGCNGGFPGAAWSY-WTRKGIVSGGPYGSNQGCRPY---EISPCEHHVNGTRPPCAH 206
            .|....| .||:||....|:.| ....|:.|...|       ||   :..||.:           
Zfish   170 DCSRPQGNNGCDGGLMDQAFQYVQDNNGLDSEESY-------PYLATDDQPCHY----------- 216

  Fly   207 GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYKD 270
               .|:.|....:|: ||....|.            ..:.:.:...|||..|... :|....|:.
Zfish   217 ---DPRYSAANVTGF-VDIPSGKE------------HALMKAVAAVGPVAVAIDAGHESFQFYQS 265

  Fly   271 GVYQHE--HGKELGGHAIRILGWGVWGEEKI--PYWLIGNSWNTDWGDHGFFRILRG-QDHCGIE 330
            |:|..:  ..:|| .|.:.::|:|..|.:..  .||::.|||...|||.|:..:.:. ::||||.
Zfish   266 GIYYEKACSTEEL-DHGVLVVGYGYEGVDVAGRRYWIVKNSWTDRWGDKGYIYMAKDLKNHCGIA 329

  Fly   331 SSIS 334
            :|.|
Zfish   330 TSAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/41 (24%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 69/258 (27%)
ctsllXP_005165198.1 Inhibitor_I29 29..87 CDD:214853 9/33 (27%)
Peptidase_C1 116..336 CDD:278538 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.