DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsql2

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001002813.2 Gene:Ctsql2 / 408201 RGDID:1303225 Length:343 Species:Rattus norvegicus


Alignment Length:271 Identity:79/271 - (29%)
Similarity:113/271 - (41%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 REVLGDLYVNS---VDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIH 131
            :..||..:.||   .|.||:..|.||:    ..:..:|:||.|.|||||   ||:|..    ...
  Rat   108 KRALGSPFPNSWYWRDALPKSIDWRKE----GYVTRVREQGKCKSCWAFPVAGAIEGQ----MFK 164

  Fly   132 SGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAAWSYWTRKGIVSGG---PYGSNQGCRPYEISP 192
            ..||:. ..|..:||.|....| .||.||....|:.|..:.|.:...   ||...:|.       
  Rat   165 KTGKLT-PLSVQNLVDCSKPQGNKGCRGGTTYNAFQYVLQNGGLESEATYPYKGKEGL------- 221

  Fly   193 CEHHVNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPV-E 256
            |:::              ||.:          |||...|    .::..:...:.:.:.|.||| .
  Rat   222 CKYN--------------PKNA----------YAKITRF----VALPEDEDVLMDALATKGPVAA 258

  Fly   257 GAFTVYEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFR 319
            |...||..|..||.|:|..........||:.::|:|..|.|.  ..||||.|||...||..|:.:
  Rat   259 GIHVVYSSLRFYKKGIYHEPKCNNRVNHAVLVVGYGFEGNETDGNNYWLIKNSWGKQWGLKGYMK 323

  Fly   320 ILRGQ-DHCGI 329
            |.:.: :||||
  Rat   324 IAKDRNNHCGI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 73/253 (29%)
Ctsql2NP_001002813.2 Inhibitor_I29 29..87 CDD:214853
Peptidase_C1 125..342 CDD:278538 74/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.