DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsc

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_012812143.2 Gene:ctsc / 407938 XenbaseID:XB-GENE-940480 Length:458 Species:Xenopus tropicalis


Alignment Length:331 Identity:102/331 - (30%)
Similarity:147/331 - (44%) Gaps:69/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFIEVVRSKAKTWTVGR--NFDASVTEGHIRRLMG------VHPDAHKFALPDKREVLGDLYVNS 83
            :|::.:....|:||...  .::....|..|||..|      :.|  ....||...:..|      
 Frog   169 DFVKQINEVQKSWTATAYPEYEGMTIEDLIRRAGGRNSRIPMRP--RPAPLPTDEKYQG------ 225

  Fly    84 VDELPEEFDSRKQWPNCP---TIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDL 145
               ||.|:|    |.|..   .:..:|:|.|||||:||.::..:..|:.|.|........|...:
 Frog   226 ---LPTEWD----WRNIAGYNFVTPVRNQASCGSCYAFSSMGMLESRIQIRSQLSQKPILSPQQV 283

  Fly   146 VSCCHTCGFGCNGGFPG-AAWSYWTRKGIV--SGGPY-GSNQGCRPYEISPCEHHVNGTRPPCAH 206
            |||.: ...||.||||. .|..|.:..|||  |..|| ||:        |||             
 Frog   284 VSCSN-YSQGCEGGFPYLIAGKYVSDYGIVEESDLPYTGSD--------SPC------------- 326

  Fly   207 GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDG 271
               |.|.|.  |..||.:|    |:....|. ..|...::.|::..||:..||.||:|.:.|:.|
 Frog   327 ---TLKDSQ--QKYYTAEY----HYVGGFYG-GCNEAYMKLELVLGGPLSVAFEVYDDFMHYRSG 381

  Fly   272 VYQHE------HGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIE 330
            ||.|.      :..:|..||:.::|:|...:....||::.|||...||:.|:|||.||.|.|.||
 Frog   382 VYHHTGLQDKFNPFQLTNHAVLLVGYGTDQQTGEKYWIVKNSWGESWGEKGYFRIRRGTDECAIE 446

  Fly   331 S-SISA 335
            | ::||
 Frog   447 SIAVSA 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/44 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 88/262 (34%)
ctscXP_012812143.2 CathepsinC_exc 20..136 CDD:400909
Peptidase_C1A_CathepsinC 226..455 CDD:239112 89/263 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.