DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and CG11459

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster


Alignment Length:327 Identity:84/327 - (25%)
Similarity:132/327 - (40%) Gaps:100/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSV--------------------DELPEEFDSRK 95
            :|.:...||:    :||:..|:|.:..  |.:|:                    |::.|..|   
  Fly    68 QGKVAFKMGL----NKFSDTDQ
RILFN--YRSSIPAPLETSTNALTETVNYKRYDQITEGID--- 123

  Fly    96 QWPNCPTIGEIRDQGS-CGSCWAF---GAVEAMSDRVCIHSGGKVN--FHFSADDLVSCCHTCGF 154
             |.....|..:.|||: |.|||||   |.:||       |...|..  ...|...||.|......
  Fly   124 -WRQYGYISPVGDQGTECLSCWAFSTSGVLEA-------HMAKKYGNLVPLSPKHLVDCVPYPNN 180

  Fly   155 GCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQS 219
            ||:||:...|::|....||.:...|       |||      .|:|            :|.     
  Fly   181 GCSGGWVSVAFNYTRDHGIATKESY-------PYE------PVSG------------ECL----- 215

  Fly   220 GYTVDYAKDKHFGSKS-YSVRRNV--REIQEEIMTNGPVEGAFT-VYEDLILYKDGVYQ----HE 276
                 :..|:..|:.| |....|.  ||:.|.:...|||..:.. ::|:...|..||..    ..
  Fly   216 -----WKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRS 275

  Fly   277 HGKELGGHAIRILGWGV---WGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH-CGIESSISAGL 337
            ..::| .|::.::|:|.   ||:    ||:|.||:.||||:.|:.::.|..:: ||:     |.|
  Fly   276 KRQDL-THSVLLVGFGTHRKWGD----YWIIKNSYGTDWGESGYLKLARNANNMCGV-----ASL 330

  Fly   338 PK 339
            |:
  Fly   331 PQ 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 3/12 (25%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/265 (27%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 5/20 (25%)
Peptidase_C1A 120..334 CDD:239068 74/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452954
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.