DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsb

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_989225.1 Gene:ctsb / 394833 XenbaseID:XB-GENE-1000505 Length:333 Species:Xenopus tropicalis


Alignment Length:343 Identity:194/343 - (56%)
Similarity:227/343 - (66%) Gaps:23/343 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLVATAASVAALTSGEPSLLSDEFIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVH---PDA 64
            :|..:|:.||...|....|  ||.:.:..:.....||..|.|| |:....:::||.|.|   |..
 Frog     7 VLCFLASIASARHLPFFAP--LSGDMVNYINKMNTTWKAGHNF-ANADLHYVKRLCGTHLNGPQL 68

  Fly    65 HK-FALPDKREVLGDLYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRV 128
            .| |...|..            |||:.||||..|||||||.|:|||||||||||||||||:||||
 Frog    69 QKRFGFADGM------------ELPDSFDSRAAWPNCPTIREVRDQGSCGSCWAFGAVEAISDRV 121

  Fly   129 CIHSGGKVNFHFSADDLVSCC-HTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISP 192
            |:|:.||||...||:||:||| ..||.|||||:|..||.:||..|:||||.|.|:.|||||.|.|
 Frog   122 CVHTNGKVNVEVSAEDLLSCCGFECGMGCNGGYPSGAWKFWTETGLVSGGLYDSHLGCRPYSIPP 186

  Fly   193 CEHHVNGTRPPC-AHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVE 256
            |||||||:||.| ...|.||||...|:.||...|..|||||:.||.|..:.:||..||..|||||
 Frog   187 CEHHVNGSRPACKGEEGDTPKCVKQCEDGYAPVYGSDKHFGATSYGVPSSEKEIMAEIYKNGPVE 251

  Fly   257 GAFTVYEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRIL 321
            |||.||.|..:||.||||||.|:|||||||:||||||  |...||||..|||||||||:|||:||
 Frog   252 GAFLVYADFPMYKSGVYQHETGEELGGHAIKILGWGV--ENGTPYWLCANSWNTDWGDNGFFKIL 314

  Fly   322 RGQDHCGIESSISAGLPK 339
            ||:|||||||.|.||:||
 Frog   315 RGKDHCGIESEIVAGIPK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 13/42 (31%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 166/249 (67%)
ctsbNP_989225.1 Propeptide_C1 26..65 CDD:369701 12/39 (31%)
Peptidase_C1A_CathepsinB 81..329 CDD:239111 166/249 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 373 1.000 Domainoid score I880
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37550
Inparanoid 1 1.050 396 1.000 Inparanoid score I1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D439739at33208
OrthoFinder 1 1.000 - - FOG0001215
OrthoInspector 1 1.000 - - oto104518
Panther 1 1.100 - - O PTHR12411
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2465
SonicParanoid 1 1.000 - - X1059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.