DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctsc

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_999887.1 Gene:ctsc / 368704 ZFINID:ZDB-GENE-030619-9 Length:455 Species:Danio rerio


Alignment Length:337 Identity:99/337 - (29%)
Similarity:141/337 - (41%) Gaps:72/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FIEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKR--------EVLGDLYVNSV 84
            |::.:.|..|:||        .|.......:.:|....:...|..|        .|..|  ..:.
Zfish   167 FVDEINSVQKSWT--------ATAYSFHETLSIHEMLRRSGGPASRIPRRVRPVTVAAD--SKAA 221

  Fly    85 DELPEEFDSRKQWPN---CPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLV 146
            ..||:.:|    |.|   ...:..:|:|..||||::|..:..:..||.|.:.......||...:|
Zfish   222 SGLPQHWD----WRNVNGVNFVSPVRNQAQCGSCYSFATMGMLEARVRIQTNNTQQPVFSPQQVV 282

  Fly   147 SCCHTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTP 211
            ||.. ...||:||||.....|....|||       .:.|.||         .|:..||   ....
Zfish   283 SCSQ-YSQGCDGGFPYLIGKYIQDFGIV-------EEDCFPY---------TGSDSPC---NLPA 327

  Fly   212 KCSHVCQSGYTVDYAKDKH-----FGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDG 271
            ||        |..||.|.|     :|..|.|.      :..|::.|||:..|..||.|.:.||:|
Zfish   328 KC--------TKYYASDYHYVGGFYGGCSESA------MMLELVKNGPMGVALEVYPDFMNYKEG 378

  Fly   272 VYQH------EHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIE 330
            :|.|      .:..||..||:.::|:|...:....||::.|||.:.||::|||||.||.|.|.||
Zfish   379 IYHHTGLRDANNPFELTNHAVLLVGYGQCHKTGEKYWIVKNSWGSGWGENGFFRIRRGTDECAIE 443

  Fly   331 SSISAG--LPKL 340
            |...|.  :|||
Zfish   444 SIAVAATPIPKL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 7/35 (20%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 83/261 (32%)
ctscNP_999887.1 CathepsinC_exc 20..132 CDD:285926
Peptidase_C1A_CathepsinC 224..452 CDD:239112 85/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.