powered by:
Protein Alignment CtsB1 and CG6357
DIOPT Version :9
Sequence 1: | NP_001259536.2 |
Gene: | CtsB1 / 32341 |
FlyBaseID: | FBgn0030521 |
Length: | 340 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610907.1 |
Gene: | CG6357 / 36532 |
FlyBaseID: | FBgn0033875 |
Length: | 439 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 16/51 - (31%) |
Similarity: | 21/51 - (41%) |
Gaps: | 11/51 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 VNSVDELPEEFDSRKQWPN-CPTIG-----EIRDQGSCGSCWA-----FGA 120
:|...:|..|....||.|. .|.|. |.||:.:|.:.|. |||
Fly 121 INQWSDLTFEEWKEKQTPKVMPEIASESSKEERDKVNCQAAWEKFLIDFGA 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.