DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB and CG6357

DIOPT Version :10

Sequence 1:NP_572920.1 Gene:CtsB / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_610907.1 Gene:CG6357 / 36532 FlyBaseID:FBgn0033875 Length:439 Species:Drosophila melanogaster


Alignment Length:51 Identity:16/51 - (31%)
Similarity:21/51 - (41%) Gaps:11/51 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VNSVDELPEEFDSRKQWPN-CPTIG-----EIRDQGSCGSCWA-----FGA 120
            :|...:|..|....||.|. .|.|.     |.||:.:|.:.|.     |||
  Fly   121 INQWSDLTFEEWKEKQTPKVMPEIASESSKEERDKVNCQAAWEKFLIDFGA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsBNP_572920.1 Propeptide_C1 24..64 CDD:462365
Peptidase_C1A_CathepsinB 88..336 CDD:239111 14/44 (32%)
CG6357NP_610907.1 Inhibitor_I29 72..132 CDD:462410 3/10 (30%)
Inhibitor_I29 162..221 CDD:214853 4/10 (40%)
Inhibitor_I29 252..311 CDD:214853
Inhibitor_I29 347..406 CDD:214853
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.