DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsf

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001029282.1 Gene:Ctsf / 361704 RGDID:1308181 Length:462 Species:Rattus norvegicus


Alignment Length:269 Identity:67/269 - (24%)
Similarity:110/269 - (40%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SVDEL-PEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLV 146
            |:::| |.|:|.||:    ..:.|::|||.|||||||.....:..:..::.|..::  .|..:|:
  Rat   244 SINDLAPPEWDWRKK----GAVTEVKDQGMCGSCWAFSVTGNVEGQWFLNRGTLLS--LSEQELL 302

  Fly   147 SCCHTCGFGCNGGFPGAAWSYWTRK---GIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGG 208
            . |......|.||.|..|  |...|   |:.:...||                         :.|
  Rat   303 D-CDKMDKACMGGLPSNA--YTAIKNLGGLETEDDYG-------------------------YQG 339

  Fly   209 RTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVY 273
            ....|:...|..        |.:.:.|..:.|:..:|...:...||:..|...:        |:.
  Rat   340 HVQACNFSTQMA--------KVYINDSVELSRDENKIAAWLAQKGPISVAINAF--------GMQ 388

  Fly   274 QHEHG-----KELGG-----HAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCG 328
            .:.||     :.|..     ||:.::|:|  ....||||.|.|||..|||:.|::.:.||...||
  Rat   389 FYRHGIAHPFRPLCSPWFIDHAVLLVGYG--NRSNIPYWAIKNSWGRDWGEEGYYYLYRGSGACG 451

  Fly   329 IESSISAGL 337
            :.:..|:.:
  Rat   452 VNTMASSAV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 65/260 (25%)
CtsfNP_001029282.1 Inhibitor_I29 165..221 CDD:214853
Peptidase_C1 249..460 CDD:395062 65/262 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343568
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.