DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and ctss2.2

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_009290599.1 Gene:ctss2.2 / 337572 ZFINID:ZDB-GENE-050626-55 Length:337 Species:Danio rerio


Alignment Length:377 Identity:92/377 - (24%)
Similarity:153/377 - (40%) Gaps:105/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NLLLLVATAASVAALTSGEPSLLSDEFIEVVRSK-AKTWT-----VGR--------------NFD 46
            :||..|..:|::|...:.     .|:..|:.:.| .|.::     |||              |.:
Zfish    12 SLLFAVCCSAALAHFNTN-----LDQHWELWKKKHVKLYSCEDEEVGRRELWERNLELIAIHNLE 71

  Fly    47 ASVTEGHIRRLMGVHPDAHKFAL-----PDKREVLGDLYVNSVDE----------------LPEE 90
            ||         ||:|  ::..|:     ....|:|..|.|..|..                :|:.
Zfish    72 AS---------MGMH--SYDLAINHMADMTTEEILQTLAVTRVPPGFKRPTAEYVSSSFAVVPDT 125

  Fly    91 FDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-F 154
            .|    |.:...:..:::||:|||||||.:|.|:..::...:|..|:  .|..:||.|....| .
Zfish   126 LD----WRDKGYVTSVKNQGACGSCWAFSSVGALEGQLMKTTGKLVD--LSPQNLVDCSSKYGNL 184

  Fly   155 GCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAH--GGRTPKCSHVC 217
            |||||:...|:.|     ::..|...| :...||:         ||:..|.:  ..|...|:   
Zfish   185 GCNGGYMSQAFQY-----VIDNGGIDS-ESSYPYQ---------GTQGSCRYDPSQRAANCT--- 231

  Fly   218 QSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAF-TVYEDLILYKDGVYQHEHGKEL 281
                           |..:..:.:.:.::|.:...|||..|. ......|.|:.|||......:.
Zfish   232 ---------------SYKFVSQGDEQALKEALANIGPVSVAIDATRPQFIFYRSGVYDDPSCTQK 281

  Fly   282 GGHAIRILGWG-VWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH-CGIES 331
            ..|.:..:|:| :.|::   |||:.|||...:||.|:.||.|.::: |||.|
Zfish   282 VNHGVLAVGYGTLSGQD---YWLVKNSWGAGFGDGGYIRIARNKNNMCGIAS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 13/59 (22%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 68/250 (27%)
ctss2.2XP_009290599.1 Inhibitor_I29 34..93 CDD:214853 13/69 (19%)
Peptidase_C1 122..336 CDD:278538 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.