DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Tinag

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001005549.1 Gene:Tinag / 300846 RGDID:1359482 Length:475 Species:Rattus norvegicus


Alignment Length:340 Identity:100/340 - (29%)
Similarity:153/340 - (45%) Gaps:47/340 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLSDEFIEVVRSKAKTWTVGRNFD----ASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNS 83
            |:..|.|:.:......|| .:|:.    .::.||...||..:.|.....::.:    :...|..:
  Rat   155 LVLPELIDHINKGDYGWT-AQNYSQFWGMTLEEGFKFRLGTLPPSPMLLSMNE----MTASYPRA 214

  Fly    84 VDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSC 148
              :|||.|.:..:||.. |.|.: ||.:|.:.|||......:||:.|.|.|:...:.|..:|:||
  Rat   215 --DLPEVFIASYKWPGW-THGPL-DQKNCAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISC 275

  Fly   149 CHTCGFGCNGGFPGAAWSYWTRKGIVSGGPY-------GSNQGCRPYEISPCEHHVNGTRPPCAH 206
            |.....|||.|....||.:..::|:||...|       .:|..|.....|......:.|| ||.:
  Rat   276 CAKNRHGCNSGSIDRAWWFLRKRGLVSHACYPLFKEQSTNNNSCAMASRSDGRGKRHATR-PCPN 339

  Fly   207 GGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDG 271
            ........:.|               |..|.:..|..||..||:.||||:....|:||...||.|
  Rat   340 SFEKSNRIYQC---------------SPPYRISSNETEIMREIIQNGPVQAIMQVHEDFFYYKTG 389

  Fly   272 VYQH--------EHGKELGGHAIRILGWG-VWGEE--KIPYWLIGNSWNTDWGDHGFFRILRGQD 325
            :|:|        |..::|..||:::.||| :.|.:  |..:|:..|||...||::|:||||||.:
  Rat   390 IYRHVVSTNEEPEKYRKLRTHAVKLTGWGTLRGAQGKKEKFWIAANSWGKSWGENGYFRILRGVN 454

  Fly   326 HCGIESSISAGLPKL 340
            ...||..|.|...:|
  Rat   455 ESDIEKLIIAAWGQL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 10/43 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 85/265 (32%)
TinagNP_001005549.1 Somatomedin_B 61..104 CDD:366428
Peptidase_C1A_CathepsinB 217..465 CDD:239111 85/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.