DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsk

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_113748.1 Gene:Ctsk / 29175 RGDID:61810 Length:329 Species:Rattus norvegicus


Alignment Length:390 Identity:100/390 - (25%)
Similarity:158/390 - (40%) Gaps:119/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLVATAASVAALTSGEPSLLSDEFIEVVRSKAKTW--TVGRNFDASVTEGHIRRL-------- 57
            |||.|.:.|            ||.|  |.:.::.:.|  |.|:.:::.|.| ..|||        
  Rat     7 LLLPVVSFA------------LSPE--ETLDTQWELWKKTHGKQYNSKVDE-ISRRLIWEKNLKK 56

  Fly    58 MGVHP-----DAHKFAL----------------------PDKREVLGD-LYVNSVD-ELPEEFDS 93
            :.||.     .||.:.|                      |..|....| ||....: .:|:..|.
  Rat    57 ISVHNLEASLGAHTYELAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSIDY 121

  Fly    94 RKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFG 155
            ||:....|    :::||.|||||||   ||:|....:    ..||: ...|..:||.|... .:|
  Rat   122 RKKGYVTP----VKNQGQCGSCWAFSSAGALEGQLKK----KTGKL-LALSPQNLVDCVSE-NYG 176

  Fly   156 CNGGFPGAAWSYWTRKGIVSGG---PY-GSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHV 216
            |.||:...|:.|..:.|.:...   || |.::.|.          .|.|       .:..||   
  Rat   177 CGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCM----------YNAT-------AKAAKC--- 221

  Fly   217 CQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPV----EGAFTVYEDLILYKDGVYQHEH 277
              .||     ::...|::. :::|.|..:       |||    :.:.|.::   .|..|||..|:
  Rat   222 --RGY-----REIPVGNEK-ALKRAVARV-------GPVSVSIDASLTSFQ---FYSRGVYYDEN 268

  Fly   278 -GKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH-CGIESSISAGLPKL 340
             .::...||:.::|:|.....|  ||:|.|||...||:.|:..:.|.::: |||.:  .|..||:
  Rat   269 CDRDNVNHAVLVVGYGTQKGNK--YWIIKNSWGESWGNKGYVLLARNKNNACGITN--LASFPKM 329

  Fly   341  340
              Rat   330  329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 14/54 (26%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 70/260 (27%)
CtskNP_113748.1 Inhibitor_I29 26..85 CDD:214853 13/59 (22%)
Peptidase_C1 115..327 CDD:278538 71/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.