DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsj

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_058817.1 Gene:Ctsj / 29174 RGDID:69241 Length:334 Species:Rattus norvegicus


Alignment Length:314 Identity:86/314 - (27%)
Similarity:124/314 - (39%) Gaps:86/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TVGRNFDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNSVDELPEEFDSRKQWPNCPTIG 104
            |.|..|..|:::..|...: .:|.|      .|:..:|         ||...|.||:....|   
  Rat    83 TTGEEFRKSLSDILIPAAV-TNPSA------QKQVSIG---------LPNFKDWRKEGYVTP--- 128

  Fly   105 EIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAAWSYW 168
             :|:||.|||||||.||.|:..::...:|...  ..|..:|:.|..:.| .||..|....|::|.
  Rat   129 -VRNQGKCGSCWAFAAVGAIEGQMFSKTGNLT--PLSVQNLLDCSKSEGNNGCRWGTAHQAFNYV 190

  Fly   169 TR-KGIVSGGPYGSNQGCRPYE--ISPCEHH-------VNG--TRPPCAHGGRTPKCSHVCQSGY 221
            .: ||:.:...|       |||  ..||.:|       :.|  ..||                  
  Rat   191 LKNKGLEAEATY-------PYEGKDGPCRYHSENASANITGFVNLPP------------------ 230

  Fly   222 TVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTVYEDLI-LYKDGVYQHEH--GKELGG 283
                               |...:...:.:.|||..|.....|.. .|..||| ||.  ...:..
  Rat   231 -------------------NELYLWVAVASIGPVSAAIDASHDSFRFYSGGVY-HEPNCSSYVVN 275

  Fly   284 HAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIESSIS 334
            ||:.::|:|..|.|.  ..||||.|||..:||.:||.:|.:.: :||||.|..|
  Rat   276 HAVLVVGYGFEGNETDGNNYWLIKNSWGEEWGINGFMKIAKDRNNHCGIASQAS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/23 (26%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 76/266 (29%)
CtsjNP_058817.1 PTZ00203 4..319 CDD:185513 80/302 (26%)
Inhibitor_I29 29..87 CDD:214853 2/3 (67%)
Peptidase_C1 114..331 CDD:278538 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.