DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and RGD1308751

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_225137.5 Gene:RGD1308751 / 290981 RGDID:1308751 Length:330 Species:Rattus norvegicus


Alignment Length:367 Identity:89/367 - (24%)
Similarity:148/367 - (40%) Gaps:84/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNLLLLVAT--AASVAALTSGEPSLLSDEFIEVVRSK-AKTWTVGRNFDASVTEGHIRRLMGVHP 62
            |..:.|:||  ...::|..:.:||.  |...|..::| .||:.............:..:::.:|.
  Rat     1 MTPIFLLATLCLGMISAAPTHDPSF--DTVWEEWKTKHGKTYNTNEEGQKRAVWENNMKMINLHN 63

  Fly    63 D-----AHKFALPDKREVLGDLYVNSVDELPEEFDS-------------------RKQWPNCPTI 103
            :     .|.|:|  :....|||......||...|.|                   ...|.....:
  Rat    64 EDYLKGKHGFSL--EMNAFGDLTNTEFRELMTGFQSMGPKETTIFREPFLGDIPKSLDWREHGYV 126

  Fly   104 GEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG-FGCNGGFPGAAWSY 167
            ..:::||.|||||||.||.::..::...:|..|:  .|..:||.|..:.| .|||||....|:.|
  Rat   127 TPVKNQGQCGSCWAFSAVGSLEGQIFKKTGKLVS--LSEQNLVDCSWSYGNLGCNGGLMEFAFQY 189

  Fly   168 -WTRKGIVSGGPYGSNQGCRPYEISP--CEHHVNGTRPPCAHGGRTPKCSHVCQSGYT-VDYAKD 228
             ...:|:.:|..|.       ||...  |.::              ||.|....:|:. |..::|
  Rat   190 VKENRGLDTGESYA-------YEAQDGLCRYN--------------PKYSAANVTGFVKVPLSED 233

  Fly   229 KHFGSKSYSVRRNVREIQEEIMTNGPVE-GAFTVYEDLILYKDGVYQHE--HGKELGGHAIRILG 290
                           ::...:.:.|||. |..:.::....|..|:|...  ...|: .||:.::|
  Rat   234 ---------------DLMSAVASVGPVSVGIDSHHQSFRFYSGGMYYEPDCSSTEM-DHAVLVVG 282

  Fly   291 WGVWGEEKI--PYWLIGNSWNTDWGDHGFFRILRGQ-DHCGI 329
               :|||..  .|||:.|||..|||..|:.::.:.| ::|||
  Rat   283 ---YGEESDGGKYWLVKNSWGEDWGMDGYIKMAKDQNNNCGI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/45 (13%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 68/272 (25%)
RGD1308751XP_225137.5 Inhibitor_I29 29..87 CDD:214853 11/59 (19%)
Peptidase_C1 114..329 CDD:278538 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.