DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsr

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_783171.2 Gene:Ctsr / 290975 RGDID:631422 Length:334 Species:Rattus norvegicus


Alignment Length:326 Identity:75/326 - (23%)
Similarity:132/326 - (40%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DEFIEVVRSKAKTWTVGRN--------FDASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVN 82
            :|.:::::...:..::|:|        |.....|...:.::.:...:|:     |.:::....|.
  Rat    53 EENMKMIKLHNRENSLGKNGFIMEMNEFGDLTAEEFRKMMVNIPIRSHR-----KGKIIRKRDVG 112

  Fly    83 SVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADD 144
            :|  ||:..|.||:    ..:..:::|..|.|||||   ||:|..    ..:..|::. ..|..:
  Rat   113 NV--LPKFVDWRKK----GYVTRVQNQKFCNSCWAFAVTGAIEGQ----MFNKTGQLT-PLSVQN 166

  Fly   145 LVSCCHTCG-FGCNGGFPGAAWSYWTRKGIVSGG---PYGSNQGCRPYEISPCEHHVNGTRPPCA 205
            ||.|..:.| .||..|.|..|:.|....|.:...   ||...:|                     
  Rat   167 LVDCTKSQGNEGCQWGDPHIAYEYVLNNGGLEAEATYPYKGKEG--------------------- 210

  Fly   206 HGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV-YEDLILYK 269
                      ||:  |...::|.:..|..|.....::  :.|.:.|.||:..|... :.....||
  Rat   211 ----------VCR--YNPKHSKAEITGFVSLPESEDI--LMEAVATIGPISVAVDASFNSFGFYK 261

  Fly   270 DGVYQHEH-GKELGGHAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFRILRGQDH-CGIE 330
            .|:|...: ......|::.::|:|..|.|.  ..||||.|||...||..|:.:|.:.|:: |.|.
  Rat   262 KGLYDEPNCSNNTVNHSVLVVGYGFEGNETDGNSYWLIKNSWGRKWGLRGYMKIPKDQNNFCAIA 326

  Fly   331 S 331
            |
  Rat   327 S 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 5/45 (11%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 65/256 (25%)
CtsrNP_783171.2 PTZ00203 7..332 CDD:185513 75/326 (23%)
Inhibitor_I29 29..87 CDD:214853 4/33 (12%)
Peptidase_C1A 116..332 CDD:239068 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.