powered by:
Protein Alignment CtsB1 and AT1G13825
DIOPT Version :9
Sequence 1: | NP_001259536.2 |
Gene: | CtsB1 / 32341 |
FlyBaseID: | FBgn0030521 |
Length: | 340 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001321995.1 |
Gene: | AT1G13825 / 28717237 |
AraportID: | AT1G13825 |
Length: | 121 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 18/56 - (32%) |
Similarity: | 28/56 - (50%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 LYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR 322
|||..:...|..:.:.||.:.:.|.|:..|..||:....::....|||.||.|:.|
plant 53 LYKPTLKIREANRRVDGHFMLLTGHGIDEESNIPFMEFQDTKGDTWGDEGFVRVRR 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.