DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CtsB1 and AT1G13825

DIOPT Version :9

Sequence 1:	NP_001259536.2	Gene:	CtsB1 / 32341	FlyBaseID:	FBgn0030521	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_001321995.1	Gene:	AT1G13825 / 28717237	AraportID:	AT1G13825	Length:	121	Species:	Arabidopsis thaliana

Alignment Length:	56	Identity:	18/56 - (32%)
Similarity:	28/56 - (50%)	Gaps:	0/56 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   267 LYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILR 322
            |||..:...|..:.:.||.:.:.|.|:..|..||:....::....|||.||.|:.|
plant    53 LYKPTLKIREANRRVDGHFMLLTGHGIDEESNIPFMEFQDTKGDTWGDEGFVRVRR 108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CtsB1	NP_001259536.2	Propeptide_C1	24..64	CDD:285358
CtsB1	NP_001259536.2	Peptidase_C1A_CathepsinB	88..336	CDD:239111	18/56 (32%)
AT1G13825	NP_001321995.1	PTZ00203	<70..116	CDD:185513	13/39 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910