DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Testin

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_775155.1 Gene:Testin / 286916 RGDID:708447 Length:333 Species:Rattus norvegicus


Alignment Length:269 Identity:61/269 - (22%)
Similarity:103/269 - (38%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LYVNSVDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSAD 143
            |||      |:..|    |.....:..:::||.|.|.|||.|..::..::...:...:  ..|..
  Rat   112 LYV------PKRVD----WRQLGYVTPVKNQGHCASSWAFSATGSLEGQMFRKTERLI--PLSEQ 164

  Fly   144 DLVSCC-HTCGFGCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHG 207
            :|:.|. .....||:|||...|:.|           ...|.|....|..|             :.
  Rat   165 NLLDCMGSNVTHGCSGGFMQYAFQY-----------VKDNGGLATEESYP-------------YR 205

  Fly   208 GRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVR------EIQEEIMTNGPV-------EGAF 259
            |:..:|.:              |..:.:.:||..|:      .:.:.:...||:       .|:|
  Rat   206 GQGRECRY--------------HAENSAANVRDFVQIPGSEEALMKAVAKVGPISVAVDASHGSF 256

  Fly   260 TVYEDLILYKDGVYQHEHGKELG-GHAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFRIL 321
            .      .|..|:|.....|.:. .||:.::|:|..|||.  ..:||:.|||..:||..|:.::.
  Rat   257 Q------FYGSGIYYEPQCKRVHLNHAVLVVGYGFEGEESDGNSFWLVKNSWGEEWGMKGYMKLA 315

  Fly   322 RG-QDHCGI 329
            :. .:||||
  Rat   316 KDWSNHCGI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358
Peptidase_C1A_CathepsinB 88..336 CDD:239111 58/260 (22%)
TestinNP_775155.1 Inhibitor_I29 29..87 CDD:214853
Peptidase_C1 114..332 CDD:395062 59/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.