DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and TINAG

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_055279.3 Gene:TINAG / 27283 HGNCID:14599 Length:476 Species:Homo sapiens


Alignment Length:350 Identity:105/350 - (30%)
Similarity:153/350 - (43%) Gaps:66/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLSDEFIEVVRSKAKTWTVGRNFD----ASVTEGHIRRLMGVHPDAHKFALPDKREVLGDLYVNS 83
            |:..|.||.|......|| .:|:.    .::.:|...||..:.|..   .|....|:...|  .:
Human   155 LVRSELIEQVNKGDYGWT-AQNYSQFWGMTLEDGFKFRLGTLPPSP---MLLSMNEMTASL--PA 213

  Fly    84 VDELPEEFDSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSC 148
            ..:|||.|.:..:||.. |.|.: ||.:|.:.|||......:||:.|.|.|:...:.|..:|:||
Human   214 TTDLPEFFVASYKWPGW-THGPL-DQKNCAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISC 276

  Fly   149 CHTCGFGCNGGFPGAAWSYWTRKGIVSGGPY-------GSNQGC----------RPYEISPCEHH 196
            |.....|||.|....||.|..::|:||...|       .:|.||          :.:...||.::
Human   277 CAKNRHGCNSGSIDRAWWYLRKRGLVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNN 341

  Fly   197 VNGTRPPCAHGGRTPKCSHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPVEGAFTV 261
            |.             |.:.:.|.             |..|.|..|..||.:|||.||||:....|
Human   342 VE-------------KSNRIYQC-------------SPPYRVSSNETEIMKEIMQNGPVQAIMQV 380

  Fly   262 YEDLILYKDGVYQH--------EHGKELGGHAIRILGWGVW---GEEKIPYWLIGNSWNTDWGDH 315
            .||...||.|:|:|        |..::|..||:::.|||..   ..:|..:|:..|||...||::
Human   381 REDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGEN 445

  Fly   316 GFFRILRGQDHCGIESSISAGLPKL 340
            |:||||||.:...||..|.|...:|
Human   446 GYFRILRGVNESDIEKLIIAAWGQL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 11/43 (26%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 87/275 (32%)
TINAGNP_055279.3 Somatomedin_B 61..104 CDD:279385
VWC 120..>154 CDD:302663
Peptidase_C1A_CathepsinB 218..466 CDD:239111 87/275 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.