DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsh

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_037071.1 Gene:Ctsh / 25425 RGDID:2447 Length:333 Species:Rattus norvegicus


Alignment Length:328 Identity:83/328 - (25%)
Similarity:135/328 - (41%) Gaps:73/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IEVVRSKAKTWTVGRNFDASVTEGHIRRLMGVHPDAHKF--ALPDKREVLGDLYVNSVDELPEEF 91
            |:....:..|:.:|.|..:.::...|:         ||:  :.|.........|:......|...
  Rat    63 IQAHNQRNHTFKMGLNQFSDMSFAEI
K---------HKYLWSEPQNCSATKSNYLRGTGPYPSSM 118

  Fly    92 DSRKQWPNCPTIGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTC-GFG 155
            |.||:.   ..:..:::||:|||||.|....|:...|.|.||..:.  .:...||.|.... ..|
  Rat   119 DWRKKG---NVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMMT--LAEQQLVDCAQNFNNHG 178

  Fly   156 CNGGFPGAAWSY-WTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQS 219
            |.||.|..|:.| ...|||:....|       ||.                  |:..:|      
  Rat   179 CQGGLPSQAFEYILYNKGIMGEDSY-------PYI------------------GKNGQC------ 212

  Fly   220 GYTVDYAKDKHFGSKSYSVRRNVREIQ--------EEIMTNGPVEGAFTVYEDLILYKDGVYQ-- 274
                     |....|:.:..:||..|.        |.:....||..||.|.||.::||.|||.  
  Rat   213 ---------KFNPEKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFMMYKSGVYSSN 268

  Fly   275 --HEHGKELGGHAIRILGWGVWGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSISAGL 337
              |:...:: .||:..:|:|  .:..:.||::.|||.::||::|:|.|.||::.||:.:..|..:
  Rat   269 SCHKTPDKV-NHAVLAVGYG--EQNGLLYWIVKNSWGSNWGNNGYFLIERGKNMCGLAACASYPI 330

  Fly   338 PKL 340
            |::
  Rat   331 PQV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 5/34 (15%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 73/261 (28%)
CtshNP_037071.1 Inhibitor_I29 33..88 CDD:400519 4/24 (17%)
Peptidase_C1 115..330 CDD:395062 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.