DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsz

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_899159.1 Gene:Ctsz / 252929 RGDID:708479 Length:306 Species:Rattus norvegicus


Alignment Length:295 Identity:75/295 - (25%)
Similarity:118/295 - (40%) Gaps:59/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LMG--VHPDAHKFALPDKREVLGDLYVNSVDELPEEFDSRKQWPNCPTI---GEIRDQ---GSCG 113
            |:|  .:|..|::..|              .:||:.:|    |.|...:   ...|:|   ..||
  Rat    46 LLGRRTYPRPHEYLSP--------------ADLPKNWD----WRNVNGVNYASVTRNQHIPQYCG 92

  Fly   114 SCWAFGAVEAMSDRVCI-HSGGKVNFHFSADDLVSCCHTCGFGCNGGFPGAAWSYWTRKGIVSGG 177
            ||||.|:..|::||:.| ..|...:...|..:::.|.:  ...|.||.....|.|..:.||    
  Rat    93 SCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDCGN--AGSCEGGNDLPVWEYAHKHGI---- 151

  Fly   178 PYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCS-----HVCQSGYTVDYAKDKHFGSKSYS 237
               .::.|..|:....|         |....:...|:     |..|: ||:....|  :||.|  
  Rat   152 ---PDETCNNYQAKDQE---------CDKFNQCGTCTEFKECHTIQN-YTLWRVGD--YGSLS-- 199

  Fly   238 VRRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHEHGKELGGHAIRILGWGVWGEEKIPYW 302
               ...::..||..|||:.......|.:..|..|:|.....:.:..|.|.:.|||| ..:.|.||
  Rat   200 ---GREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAIINHIISVAGWGV-SNDGIEYW 260

  Fly   303 LIGNSWNTDWGDHGFFRILRGQDHCGIESSISAGL 337
            ::.|||...||:.|:.||:......|..||.:..:
  Rat   261 IVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 3/8 (38%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 69/259 (27%)
CtszNP_899159.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 70/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.