DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsB1 and Ctsq

DIOPT Version :9

Sequence 1:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_640355.1 Gene:Ctsq / 246147 RGDID:631421 Length:343 Species:Rattus norvegicus


Alignment Length:317 Identity:84/317 - (26%)
Similarity:122/317 - (38%) Gaps:75/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TWTVGRNFDASVTEGHIR-RLMGVHPDAHKFALP----DKR---EVLGDLYVNS---VDELPEEF 91
            |:|:..|..|.:|:...: .::|       |.||    :||   ..||..:.||   .|.||:..
  Rat    72 TYTMEINDFADMTDEEFKDMIIG-------FQLPVHNTEKRLWKRALGSFFPNSWNWRDALPKFV 129

  Fly    92 DSRKQWPNCPTIGEIRDQGSCGSCWAF---GAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCG 153
            |    |.|...:..:|.||.|.|||||   ||:|..    .....||: ...|..:|:.|....|
  Rat   130 D----WRNEGYVTRVRKQGGCSSCWAFPVTGAIEGQ----MFKKTGKL-IPLSVQNLIDCSKPQG 185

  Fly   154 -FGCNGGFPGAAWSYWTRKGIVSGG---PYGSNQG-CRPYEISPCEHHVNGTRPPCAHGGRTPKC 213
             .||..|....|:.|....|.:...   ||...:| ||                      ..||.
  Rat   186 NRGCLWGNTYNAFQYVLHNGGLEAEATYPYERKEGVCR----------------------YNPKN 228

  Fly   214 SHVCQSGYTVDYAKDKHFGSKSYSVRRNVREIQEEIMTNGPV-EGAFTVYEDLILYKDGVYQHEH 277
            |....:|:.|              :..:...:.:.:.|.||: .|...:......|:.|||....
  Rat   229 SSAKITGFVV--------------LPESEDVLMDAVATKGPIATGVHVISSSFRFYQKGVYHEPK 279

  Fly   278 GKELGGHAIRILGWGVWGEEK--IPYWLIGNSWNTDWGDHGFFRILRGQ-DHCGIES 331
            ......||:.::|:|..|.|.  ..||||.|||...||..|:.:|.:.: :||.|.|
  Rat   280 CSSYVNHAVLVVGYGFEGNETDGNNYWLIKNSWGKRWGLRGYMKIAKDRNNHCAIAS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 6/26 (23%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 67/256 (26%)
CtsqNP_640355.1 PTZ00203 4..341 CDD:185513 84/317 (26%)
Inhibitor_I29 29..87 CDD:214853 5/14 (36%)
Peptidase_C1 125..342 CDD:278538 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.